c8-4 vector (V010043)

Basic Vector Information

      • Vector Name:
      • c8-4
      • Antibiotic Resistance:
      • Chloramphenicol
      • Length:
      • 7775 bp
      • Type:
      • Filamentous phage display vector
      • Source/Author:
      • Petrenko VA, Smith GP, Mazooji MM, Quinn T.

c8-4 vector Vector Map

c8-47775 bp3006009001200150018002100240027003000330036003900420045004800510054005700600063006600690072007500replication protein pXcytosolic single-stranded DNA binding protein pVminor coat protein pVIImajor coat protein pVIII precursorfd terminatoradsorption protein pIII precursorminor coat protein pVImorphogenetic protein pIcat promoterchloramphenicol acetyl transferase

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

c8-4 vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       Exported                7775 bp ds-DNA     circular SYN 17-DEC-2018
DEFINITION  Filamentous phage display vector c8-4, complete sequence.
ACCESSION   AF464139
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 7775)
  AUTHORS   Petrenko VA, Smith GP, Mazooji MM, Quinn T.
  TITLE     An Alpha-Helically Constrained Phage Display Library
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7775)
  AUTHORS   Petrenko VA, Smith GP.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-DEC-2001) Pathobiology, Auburn University, 253 Greene 
            Hall, Auburn, AL 36849, USA
REFERENCE   3  (bases 1 to 7775)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..7775
                     /organism="Filamentous phage display vector c8-4"
                     /focus
                     /mol_type="genomic DNA"
                     /note="constructed by engineering several single-base-pair 
                     substitutions into gene VIII of filamentous phage cloning 
                     vector f8-1, deposited in GenBank Accession number 
                     AF218734, with replacement of its teracycline resistance 
                     confering genes for chloramphenicol resistance confering 
                     gene; vector is intended as a phage-display vector and has 
                     PstI, BamHI and NheI cloning sites in gene VIII and confers
                     chloramphenicol resistance to the host Escherichia coli 
                     cells; 'Stiffers' between these cloning sites can be 
                     replaced with degenerate coding sequences to create 
                     libraries of phage displaying different random peptides in 
                     exposed area of all 4000 copies of the major coat protein 
                     pVIII"
                     /db_xref="taxon:184975"
     source          1..5670
                     /organism="Filamentous phage display vector f8-1"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:127588"
     source          5671..6782
                     /organism="Cloning vector pBR325"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:198930"
     source          6783..7775
                     /organism="Filamentous phage display vector f8-1"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:127588"
     CDS             496..831
                     /codon_start=1
                     /product="replication protein pX"
                     /label=replication protein pX
                     /protein_id="AAM73896.1"
                     /translation="MNIYDDSAVLDAIQSKHFTITPSGKTSFAKASRYFGFYRRLVNEG
                     YDSVALTMPRNSFWRYVSALVECGIPKSQLMNLSTCNNVVPLVRFINVDFSSQRPDWYN
                     EPVLKIA"
     CDS             843..1106
                     /codon_start=1
                     /product="cytosolic single-stranded DNA binding protein pV"
                     /label=cytosolic single-stranded DNA binding protein pV
                     /protein_id="AAM73897.1"
                     /translation="MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYVDLGNEYPVLV
                     KITLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLRLVPAK"
     CDS             1108..1209
                     /codon_start=1
                     /product="minor coat protein pVII"
                     /label=minor coat protein pVII
                     /protein_id="AAM73898.1"
                     /translation="MEQVADFDTIYQAMIQISVVLCFALGIIAGGQR"
     CDS             1206..1304
                     /codon_start=1
                     /product="minor coat protein pIX"
                     /label=minor coat protein pIX
                     /protein_id="AAM73899.1"
                     /translation="MSVLVYSFASFVLGWCLRSGITYFTRLMETSS"
     CDS             1301..1522
                     /codon_start=1
                     /product="major coat protein pVIII precursor"
                     /label=major coat protein pVIII precursor
                     /protein_id="AAM73900.1"
                     /translation="MKKSLVLKASVAVATLVPMLSFAAEGEDPAKAAFDSLQASATEYI
                     GYAWAMVVVIVGATIGIKLFKKFTSKAS"
     terminator      1526..1574
                     /label=fd terminator
                     /note="central terminator from bacteriophage fd (Otsuka and
                     Kunisawa, 1982)"
     CDS             1579..2853
                     /codon_start=1
                     /product="adsorption protein pIII precursor"
                     /label=adsorption protein pIII precursor
                     /protein_id="AAM73901.1"
                     /translation="MKKLLFAIPLVVPFYSHSAETVESCLAKPHTENSFTNVWKDDKTL
                     DRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENEGGGSEGGGSEGGGSEGGG
                     TKPPEYGDTPIPGYTYINPLDGTYPPGTEQNPANPNPSLEESQPLNTFMFQNNRFRNRQ
                     GALTVYTGTVTQGTDPVKTYYQYTPVSSKAMYDAYWNGKFRDCAFHSGFNEDPFVCEYQ
                     GQSSDLPQPPVNAGGGSGGGSGGGSEGGGSEGGGSEGGGSEGGGSGGGSGSGDFDYEKM
                     ANANKGAMTENADENALQSDAKGKLDSVATDYGAAIDGFIGDVSGLANGNGATGDFAGS
                     NSQMAQVGDGDNSPLMNNFRQYLPSLPQSVECRPYVFGAGKPYEFSIDCDKINLFRGVF
                     AFLLYVATFMYVFSTFANILRNKES"
     CDS             2856..3194
                     /codon_start=1
                     /product="minor coat protein pVI"
                     /label=minor coat protein pVI
                     /protein_id="AAM73902.1"
                     /translation="MPVLLGIPLLLRFLGFLLVTLFGYLLTFLKKGFGKIAIAISLFLA
                     LIIGLNSILVGYLSDISAQLPSDFVQGVQLILPSNALPCFYVILSVKAAIFIFDVKQKI
                     VSYLDWDK"
     CDS             3197..4243
                     /codon_start=1
                     /product="morphogenetic protein pI"
                     /label=morphogenetic protein pI
                     /protein_id="AAM73903.1"
                     /translation="MAVYFVTGKLGSGKTLVSVGKIQDKIVAGCKIATNLDLRLQNLPQ
                     VGRFAKTPRVLRIPDKPSISDLLAIGRGNDSYDENKNGLLVLDECGTWFNTRSWNDKER
                     QPIIDWFLHARKLGWDIIFLVQDLSIVDKQARSALAEHVVYCRRLDRITLPFVGTLYSL
                     VTGSKMPLPKLHVGVVKYGDSQLSPTVERWLYTGKNLYNAYDTKQAFSSNYDSGVYSYL
                     TPYLSHGRYFKPLNLGQKMKLTKIYLKKFSRVLCLAIGFASAFTYSYITQPKPEVKKVV
                     SQTYDFDKFTIDSSQRLNLSYRYVFKDSKGKLINSDDLQKQGYSITYIDLCTVSIKKGN
                     SNEIVKCN"
     CDS             4221..5501
                     /codon_start=1
                     /product="morphogenetic protein IV"
                     /label=morphogenetic protein IV
                     /protein_id="AAM73904.1"
                     /translation="MKLLNVINFVFLMFVSSSSFAQVIEMNNSPLRDFVTWYSKQTGES
                     VIVSPDVKGTVTVYSSDVKPENLRNFFISVLRANNFDMVGSIPSIIQKYNPNSQDYIDE
                     LPSSDIQEYDDNSAPSGGFFVPQNDNVTQTFKINNVRAKDLIRVVELFVKSNTSKSSNV
                     LSVDGSNLLVVSAPKDILDNLPQFLSTVDLPTDQILIEGLIFEVQQGDALDFSFAAGSQ
                     RGTVAGGVNTDRLTSVLSSAGGSFGIFNGDVLGLSVRALKTNSHSKILSVPRILTLSGQ
                     KGSISVGQNVPFITGRVTGESANVNNPFQTVERQNVGISMSVFPVAMAGGNIVLDITSK
                     ADSLSSSTQASDVITNQRSIATTVNLRDGQTLLLGGLTDYKNTSQDSGVPFLSKIPLIG
                     LLFSSRSDSNEESTLYVLVKATIVRAL"
     promoter        5775..5877
                     /label=cat promoter
                     /note="promoter of the E. coli cat gene encoding 
                     chloramphenicol acetyltransferase"
     CDS             5878..6537
                     /codon_start=1
                     /product="chloramphenicol acetyl transferase"
                     /label=chloramphenicol acetyl transferase
                     /protein_id="AAM73894.1"
                     /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
                     KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
                     LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
                     DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"
     CDS             7374..831
                     /codon_start=1
                     /product="replication protein pII"
                     /label=replication protein pII
                     /protein_id="AAM73895.1"
                     /translation="MIDMLVLRLPFIDSLVCSRLSGNDLIAFVDLSKIATLSGMNLSAR
                     TVEYHIDGDLTVSGLSHPFESLPTHYSGIAFKIYEGSKNFYPCVEIKASPAKVLQGHNV
                     FGTTDLALCSEALLLNFANSLPCLYDLLDVNATTISRIDATFSARAPNENIAKQVIDHL
                     RNVSNGQTKSTRSQNWESTVTWNETSRHRTLVAYLKHVELQHQIQQLSSKPSAKMTSYQ
                     KEQLKVLSNPDLLEFASGLVRFEARIETRYLKSFGLPLNLFDAIRFASDYNRQGKDLIF
                     DLWSFSFSELFKAFEGDSMNIYDDSAVLDAIQSKHFTITPSGKTSFAKASRYFGFYRRL
                     VNEGYDSVALTMPRNSFWRYVSALVECGIPKSQLMNLSTCNNVVPLVRFINVDFSSQRP
                     DWYNEPVLKIA"

This page is informational only.