NovoPro
Cart 2

AAV-hSyn-Jaws-mRuby2-8X2C vector

Basic Vector Information

Basic Vector Information
Vector Name AAV-hSyn-Jaws-mRuby2-8X2C Length 3798 bp
Type Cloning vector Source Tseng H-a., Ta T, Gritton HJ, Man H-Y.

AAV-hSyn-Jaws-mRuby2-8X2C vector Vector Map

AAV-hSyn-Jaws-mRuby2-8X2C vector Sequence

Copy Sequence

Download SnapGene Map(.dna)

Download GeneBank File(.gb)

LOCUS       Exported                3798 bp ds-DNA     circular SYN 17-DEC-2018
DEFINITION  Cloning vector AAV-hSyn-Jaws-mRuby2-8X2C, complete sequence.
ACCESSION   MH458081
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 3798)
  AUTHORS   Tseng H-a., Ta T, Gritton HJ, Man H-Y.
  TITLE     A microRNA-based gene targeting tool for virally labeling 
            interneurons in the rodent cortex
  JOURNAL   Cell Rep (2018) In press
REFERENCE   2  (bases 1 to 3798)
  AUTHORS   Keaveney MK, Han X.
  TITLE     Direct Submission
  JOURNAL   Submitted (07-JUN-2018) Biomedical Engineering, Boston University, 
            610 Commonwealth Ave, Boston, MA 02215, USA
REFERENCE   3  (bases 1 to 3798)
  AUTHORS   .
  TITLE     Direct Submission
  JOURNAL   Exported Dec 18, 2018 from SnapGene 4.1.8
            http://www.snapgene.com
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: APE Plasmid Editor v. v2.0.53.c
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..3798
                     /organism="Cloning vector AAV-hSyn-Jaws-mRuby2-8X2C"
                     /mol_type="other DNA"
                     /db_xref="taxon:2250249"
     repeat_region   1..101
                     /label=5'ITR
                     /note="5'ITR"
     regulatory      197..677
                     /regulatory_class="promoter"
                     /note="hSyn"
     promoter        224..671
                     /label=hSyn promoter
                     /note="human synapsin I promoter; confers neuron-specific 
                     expression (Kugler et al., 2003)"
     regulatory      684..692
                     /regulatory_class="ribosome_binding_site"
     CDS             696..2270
                     /codon_start=1
                     /product="Jaws-mRUby2-ER2"
                     /label=Jaws-mRUby2-ER2
                     /protein_id="AWX65709.1"
                     /translation="TAVSTTATTVLQATQSDVLQEIQSNFLLNSSIWVNIALAGVVILL
                     FVAMGRDLESPRAKLIWVATMLVPLVSISSYAGLASGLTVGFLQMPPGHALAGQEVLSP
                     WGRYLTWTFSTPMILLALGLLADTDIASLFTAITMDIGMCVTGLAAALITSSHLLRWVF
                     YGISCAFFVAVLYVLLVQWPADAEAAGTSEIFGTLRILTVVLWLGYPILFALGSEGVAL
                     LSVGVTSWGYSGLDILAKYVFAFLLLRWVAANEGTVSGSGMGIGSGGAAPADDRPVVSK
                     GEELIKENMRMKVVMEGSVNGHQFKCTGEGEGNPYMGTQTMRIKVIEGGPLPFAFDILA
                     TSFMYGSRTFIKYPKGIPDFFKQSFPEGFTWERVTRYEDGGVVTVMQDTSLEDGCLVYH
                     VQVRGVNFPSNGPVMQKKTKGWEPNTEMMYPADGGLRGYTHMALKVDGGGHLSCSFVTT
                     YRSKKTVGNIKMPGIHAVDHRLERLEESDNEMFVVQREHAVAKFAGLGGGMDELYKLYK
                     FCYENEV"
     CDS             1530..2237
                     /codon_start=1
                     /product="monomeric red fluorescent protein derived from 
                     mRuby, with improved photophysical properties (Lam et al., 
                     2012)"
                     /label=mRuby2
                     /translation="VSKGEELIKENMRMKVVMEGSVNGHQFKCTGEGEGNPYMGTQTMR
                     IKVIEGGPLPFAFDILATSFMYGSRTFIKYPKGIPDFFKQSFPEGFTWERVTRYEDGGV
                     VTVMQDTSLEDGCLVYHVQVRGVNFPSNGPVMQKKTKGWEPNTEMMYPADGGLRGYTHM
                     ALKVDGGGHLSCSFVTTYRSKKTVGNIKMPGIHAVDHRLERLEESDNEMFVVQREHAVA
                     KFAGLGGGMDELYK"
     ncRNA           complement(2270..2285)
                     /label=miRNA
                     /note="microRNA"
                     /ncRNA_class="miRNA"
     misc_feature    2748..3336
                     /label=WPRE
                     /note="woodchuck hepatitis virus posttranscriptional 
                     regulatory element"
     misc_feature    2750..3337
                     /label=WPRE
                     /note="WPRE"
     CDS             complement(3219..3230)
                     /codon_start=1
                     /product="Factor Xa recognition and cleavage site"
                     /label=Factor Xa site
                     /translation="IEGR"
     primer_bind     complement(3339..3355)
                     /label=KS primer
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     polyA_signal    3385..3506
                     /label=SV40 poly(A) signal
                     /note="SV40 polyadenylation signal"
     repeat_region   3609..3798
                     /label=3'ITR
                     /note="3'ITR"

This page is informational only.