AAV-CamKIIalpha-ChR2-EGFP vector (V010132)

Basic Vector Information

      • Vector Name:
      • AAV-CamKIIalpha-ChR2-EGFP
      • Length:
      • 4259 bp
      • Type:
      • Cloning vector
      • Source/Author:
      • Tseng H-a., Ta T, Gritton HJ, Man H-Y.

AAV-CamKIIalpha-ChR2-EGFP vector Vector Map

AAV-CamKIIalpha-ChR2-EGFP4259 bp6001200180024003000360042005'ITRCamKIIalphaChR2WPREKS primerSV40 poly(A) signal3'ITR

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

AAV-CamKIIalpha-ChR2-EGFP vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       Exported                4259 bp ds-DNA     circular SYN 17-DEC-2018
DEFINITION  Cloning vector AAV-CamKIIalpha-ChR2-EGFP, complete sequence.
ACCESSION   MH458082
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 4259)
  AUTHORS   Tseng H-a., Ta T, Gritton HJ, Man H-Y.
  TITLE     A microRNA-based gene targeting tool for virally labeling 
            interneurons in the rodent cortex
  JOURNAL   Cell Rep (2018) In press
REFERENCE   2  (bases 1 to 4259)
  AUTHORS   Keaveney MK, Han X.
  TITLE     Direct Submission
  JOURNAL   Submitted (07-JUN-2018) Biomedical Engineering, Boston University, 
            610 Commonwealth Ave, Boston, MA 02215, USA
REFERENCE   3  (bases 1 to 4259)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: APE Plasmid Editor v. v2.0.53.c
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..4259
                     /organism="Cloning vector AAV-CamKIIalpha-ChR2-EGFP"
                     /mol_type="other DNA"
                     /db_xref="taxon:2250245"
     repeat_region   1..101
                     /label=5'ITR
                     /note="5'ITR"
     regulatory      197..1487
                     /regulatory_class="promoter"
                     /note="CamKIIalpha"
     regulatory      1493..1504
                     /regulatory_class="ribosome_binding_site"
     regulatory      1499..1508
                     /regulatory_class="other"
                     /note="vertebrate consensus sequence for strong initiation 
                     of translation (Kozak, 1987)"
     CDS             1505..2431
                     /codon_start=1
                     /product="N-terminal fragment of channelrhodopsin-2 from 
                     the alga Chlamydomonas reinhardtii (Nagel et al., 2003)"
                     /label=ChR2
                     /note="blue light-activated cation channel"
                     /translation="MDYGGALSAVGRELLFVTNPVVVNGSVLVPEDQCYCAGWIESRGT
                     NGAQTASNVLQWLAAGFSILLLMFYAYQTWKSTCGWEEIYVCAIEMVKVILEFFFEFKN
                     PSMLYLATGHRVQWLRYAEWLLTCPVILIHLSNLTGLSNDYSRRTMGLLVSDIGTIVWG
                     ATSAMATGYVKVIFFCLGLCYGANTFFHAAKAYIEGYHTVPKGRCRQVVTGMAWLFFVS
                     WGMFPILFILGPEGFGVLSVYGSTVGHTIIDLMSKNCWGLLGHYLRVLIHEHILIHGDI
                     RKTTKLNIGGTEIEVETLVEDEAEAGAV"
     CDS             1508..3169
                     /codon_start=1
                     /product="ChR2-EGFP"
                     /label=ChR2-EGFP
                     /protein_id="AWX65710.1"
                     /translation="DYGGALSAVGRELLFVTNPVVVNGSVLVPEDQCYCAGWIESRGTN
                     GAQTASNVLQWLAAGFSILLLMFYAYQTWKSTCGWEEIYVCAIEMVKVILEFFFEFKNP
                     SMLYLATGHRVQWLRYAEWLLTCPVILIHLSNLTGLSNDYSRRTMGLLVSDIGTIVWGA
                     TSAMATGYVKVIFFCLGLCYGANTFFHAAKAYIEGYHTVPKGRCRQVVTGMAWLFFVSW
                     GMFPILFILGPEGFGVLSVYGSTVGHTIIDLMSKNCWGLLGHYLRVLIHEHILIHGDIR
                     KTTKLNIGGTEIEVETLVEDEAEAGAVPAAPVVAVSKGEELFTGVVPILVELDGDVNGH
                     KFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFF
                     KSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEY
                     NYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLS
                     TQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK"
     CDS             2453..3169
                     /codon_start=1
                     /product="enhanced GFP"
                     /label=EGFP
                     /note="mammalian codon-optimized"
                     /translation="VSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLK
                     FICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDG
                     NYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKV
                     NFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLE
                     FVTAAGITLGMDELYK"
     misc_feature    3209..3797
                     /label=WPRE
                     /note="woodchuck hepatitis virus posttranscriptional 
                     regulatory element"
     misc_feature    3211..3798
                     /label=WPRE
                     /note="WPRE"
     CDS             complement(3680..3691)
                     /codon_start=1
                     /product="Factor Xa recognition and cleavage site"
                     /label=Factor Xa site
                     /translation="IEGR"
     primer_bind     complement(3800..3816)
                     /label=KS primer
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     polyA_signal    3846..3967
                     /label=SV40 poly(A) signal
                     /note="SV40 polyadenylation signal"
     repeat_region   4070..4259
                     /label=3'ITR
                     /note="3'ITR"

This page is informational only.