SCRPSY vector (V001595)

Basic Vector Information

      • Vector Name:
      • SCRPSY
      • Antibiotic Resistance:
      • Ampicillin
      • Length:
      • 7730 bp
      • Type:
      • Lentiviral vector
      • Source/Author:
      • Wilson SJ.

SCRPSY vector Vector Map

SCRPSY7730 bp3006009001200150018002100240027003000330036003900420045004800510054005700600063006600690072007500CMV IE promoterHIV-1 PsiPsi - packaging sequencePAC2ATagRFPcPPT/CTSTatRRE - Rev response elementNEST7 promoterattB1attB23' LTRAmpR promoterbeta-lactamaseSV40 promoter

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

SCRPSY vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       Exported                7730 bp ds-DNA     circular SYN 18-DEC-2018
DEFINITION  Lentiviral vector SCRPSY, complete sequence.
ACCESSION   KT368137
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 7730)
  AUTHORS   Wilson SJ.
  TITLE     ISG expression-screening reveals multiple antiretroviral effectors
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7730)
  AUTHORS   Wilson SJ.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-AUG-2015) MRC Centre for Virus Research, University of
            Glasgow, 464 Bearsden Road, Glasgow, Scotland G61 1QH, UK
REFERENCE   3  (bases 1 to 7730)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing 
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7730
                     /organism="Lentiviral vector SCRPSY"
                     /mol_type="other DNA"
                     /db_xref="taxon:1868477"
     regulatory      4..590
                     /regulatory_class="promoter"
                     /note="CMV IE promoter"
     enhancer        64..367
                     /label=CMV enhancer
                     /note="human cytomegalovirus immediate early enhancer"
     repeat_region   584..764
                     /label=R and U5 of HIV-1 LTR
                     /note="R and U5 of HIV-1 LTR"
     LTR             584..764
                     /label=5' LTR (truncated)
                     /note="truncated 5' long terminal repeat (LTR) from HIV-1"
     misc_feature    811..936
                     /label=HIV-1 Psi
                     /note="packaging signal of human immunodeficiency virus 
                     type 1"
     misc_feature    992..1129
                     /label=Psi - packaging sequence
                     /note="Psi - packaging sequence"
     CDS             1349..2710
                     /codon_start=1
                     /product="PAC2ATagRFP"
                     /label=PAC2ATagRFP
                     /note="PAC (puromycin acetyl transferase) 2A 
                     (stop-start/skip from FMDV) TagRFP (red fluorescent 
                     protein)"
                     /protein_id="ANN89731.1"
                     /translation="MTEYKPTVRLATRDDVPRAVRTLAAAFADYPATRHTVDPDRHIER
                     VTELQELFLTRVGLDIGKVWVADDGAAVAVWTTPESVEAGAVFAEIGPRMAELSGSRLA
                     AQQQMEGLLAPHRPKEPAWFLATVGVSPDHQGKGLGSAVVLPGVEAAERAGVPAFLETS
                     APRNLPFYERLGFTVTADVEVPEGPRTWCMTRKPGAGSGEGRGSLLTCGDVEENPGPGS
                     MSELIKENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTMRIKVVEGGPLPFAFDILA
                     TSFMYGSRTFINHTQGIPDFFKQSFPEGFTWERVTTYEDGGVLTATQDTSLQDGCLIYN
                     VKIRGVNFPSNGPVMQKKTLGWEANTEMLYPADGGLEGRSDMALKLVGGGHLICNFKTT
                     YRSKKPAKNLKMPGVYYVDHRLERIKEADKETYVEQHEVAVARYCDLPSKLGHK"
     CDS             1955..2008
                     /codon_start=1
                     /product="2A peptide from Thosea asigna virus capsid 
                     protein"
                     /label=T2A
                     /note="Eukaryotic ribosomes fail to insert a peptide bond 
                     between the Gly and Pro residues, yielding separate 
                     polypeptides."
                     /translation="EGRGSLLTCGDVEENPGP"
     misc_feature    2803..2920
                     /label=cPPT/CTS
                     /note="central polypurine tract and central termination 
                     sequence of HIV-1"
     CDS             join(2984..3198,4178..4223)
                     /codon_start=1
                     /product="Tat"
                     /label=Tat
                     /protein_id="ANN89733.1"
                     /translation="MEPVDPRLEPWKHPGSQPKTACTNCYCKKCCFHCQVCFMTKALGI
                     SYGRKKRRQRRRAHQNSQTHQASLSKQPTSQSRGDPTGPKE"
     CDS             join(3123..3198,4178..4452)
                     /codon_start=1
                     /product="Rev"
                     /label=Rev
                     /protein_id="ANN89734.1"
                     /translation="MAGRSGDSDEELIRTVRLIKLLYQSNPPPNPEGTRQARRNRRRRW
                     RERQRQIHSISERILSTYLGRSAEPVPLQLPPLERLTLDCNEDCGTSGTQGVGSPQILV
                     ESPTILESGAKE"
     misc_feature    3568..3801
                     /label=RRE - Rev response element
                     /note="RRE - Rev response element"
     CDS             4324..4350
                     /codon_start=1
                     /product="nuclear export signal from the HIV Rev protein 
                     (Fischer et al., 1995)"
                     /label=NES
                     /translation="LPPLERLTL"
     promoter        4475..4493
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     misc_recomb     4523..4547
                     /label=attB1
                     /note="attB1"
     protein_bind    4523..4547
                     /gene="mutant version of attB"
                     /label=attB1
                     /bound_moiety="BP Clonase(TM)"
                     /note="recombination site for the Gateway(R) BP reaction"
     misc_recomb     4615..4639
                     /label=attB2
                     /note="attB2"
     protein_bind    complement(4615..4639)
                     /gene="mutant version of attB"
                     /label=attB2
                     /bound_moiety="BP Clonase(TM)"
                     /note="recombination site for the Gateway(R) BP reaction"
     repeat_region   4699..5334
                     /label=3' LTR
                     /note="3' LTR"
     LTR             4700..5334
                     /label=5' LTR
                     /note="5' long terminal repeat (LTR) from HIV-1"
     promoter        5443..5547
                     /gene="bla"
                     /label=AmpR promoter
     regulatory      5478..5506
                     /regulatory_class="promoter"
                     /note="AmpR; ampicillin resistance gene; beta lactamase 
                     promoter"
     CDS             5548..6408
                     /codon_start=1
                     /product="beta-lactamase"
                     /function="confers ampicillin resistance"
                     /label=beta-lactamase
                     /protein_id="ANN89732.1"
                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW
                     EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS
                     LIKHW"
     promoter        complement(7518..7714)
                     /label=SV40 promoter
                     /note="SV40 early promoter"
     rep_origin      7532..7667
                     /label=SV40 ori
                     /note="SV40 origin of replication"
     rep_origin      7590..7667
                     /label=SV40 origin
                     /note="SV40 origin"

This page is informational only.