RHIP1pGW vector (V001606)

Basic Vector Information

      • Vector Name:
      • RHIP1pGW
      • Antibiotic Resistance:
      • Chloramphenicol
      • Length:
      • 3235 bp
      • Type:
      • Cloning vector
      • Source/Author:
      • Reis RS.

RHIP1pGW vector Vector Map

RHIP1pGW3235 bp6001200180024003000attR1lac UV5 promoterCmRccdBattR2attB2

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

RHIP1pGW vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       Exported                3235 bp ds-DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector RHIP1pGW, complete sequence.
ACCESSION   MH552886
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 3235)
  AUTHORS   Reis RS.
  TITLE     Expression vector for protoplast transformation
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 3235)
  AUTHORS   Reis RS.
  TITLE     Direct Submission
  JOURNAL   Submitted (29-JUN-2018) Department of Plant Molecular Biology, 
            University of Lausanne, Quartier UNIL-Sorge, Batiment Biophore, 
            Lausanne, Vaud 1015, Switzerland
REFERENCE   3  (bases 1 to 3235)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing 
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..3235
                     /organism="Cloning vector RHIP1pGW"
                     /mol_type="other DNA"
                     /db_xref="taxon:2267684"
     regulatory      5..1130
                     /regulatory_class="promoter"
     protein_bind    1151..1275
                     /gene="mutant version of attR"
                     /label=attR1
                     /bound_moiety="LR Clonase(TM)"
                     /note="recombination site for the Gateway(R) LR reaction"
     promoter        1300..1330
                     /label=lac UV5 promoter
                     /note="E. coli lac promoter with an ""up"" mutation"
     CDS             1384..2043
                     /codon_start=1
                     /gene="cat"
                     /product="chloramphenicol acetyltransferase"
                     /label=CmR
                     /note="confers resistance to chloramphenicol"
                     /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
                     KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
                     LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
                     DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"
     CDS             2385..2690
                     /codon_start=1
                     /gene="ccdB"
                     /product="CcdB, a bacterial toxin that poisons DNA gyrase"
                     /label=ccdB
                     /note="Plasmids containing the ccdB gene cannot be 
                     propagated in standard E. coli strains."
                     /translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDK
                     VSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI"
     protein_bind    complement(2731..2855)
                     /gene="mutant version of attR"
                     /label=attR2
                     /bound_moiety="LR Clonase(TM)"
                     /note="recombination site for the Gateway(R) LR reaction"
     protein_bind    complement(3145..3169)
                     /gene="mutant version of attB"
                     /label=attB2
                     /bound_moiety="BP Clonase(TM)"
                     /note="recombination site for the Gateway(R) BP reaction"

This page is informational only.