RCAS-L14 vector (V001609)

Basic Vector Information

      • Vector Name:
      • RCAS-L14
      • Antibiotic Resistance:
      • Ampicillin
      • Length:
      • 11572 bp
      • Type:
      • Cloning vector
      • Source/Author:
      • Komaguchi C, Kawakami Y, Nohno T.

RCAS-L14 vector Vector Map

RCAS-L1411572 bp50010001500200025003000350040004500500055006000650070007500800085009000950010000105001100011500pBR322-derived sequencegagpolpolylinker sequenceRSV promoterpBR322-derived sequence

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

RCAS-L14 vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       Exported               11572 bp ds-DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector RCAS-L14 DNA, complete sequence.
ACCESSION   AB105370
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 11572)
  AUTHORS   Komaguchi C, Kawakami Y, Nohno T.
  TITLE     Nucleotide sequence of retroviral cloning vector, RCAS-L14
  JOURNAL   Published Only in Database (2003)
REFERENCE   2  (bases 1 to 11572)
  AUTHORS   Nohno T.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-MAR-2003) Tsutomu Nohno, Kawasaki Medical School, 
            Department of Molecular Biology; 577 Matsushima, Kurashiki, Okayama 
            701-0192, Japan (E-mail:nohno@bcc.kawasaki-m.ac.jp, 
            Tel:81-86-462-1111(ex.83501), Fax:81-86-462-1199)
REFERENCE   3  (bases 1 to 11572)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..11572
                     /organism="Cloning vector RCAS-L14"
                     /mol_type="other DNA"
                     /db_xref="taxon:224009"
     misc_feature    1..4
                     /label=pBR322-derived sequence
                     /note="pBR322-derived sequence"
     repeat_region   139..438
     promoter        139..400
                     /label=RSV promoter
                     /note="Rous sarcoma virus enhancer/promoter"
     CDS             739..2850
                     /codon_start=1
                     /gene="gag"
                     /product="gag protein"
                     /label=gag
                     /protein_id="BAC65349.1"
                     /translation="MEAVIKVISSACKTYCGKISPSKKEIGAMLSLLQKEGLLMSPSDL
                     YSPGSWDPITAALSQRAMVLGKSGELKTWGLVLGALKAAREEQVTSEQAKFWLGLGGGR
                     VSPPGPECIEKPATERRIDKGEEVGETTVQRDAKMAPEEAATPKTVGTSCYHCGTAVGC
                     NCATATASAPPPPYVGSGLYPSLAGVGEQQGQGDNTSRGAEQPREEPGHAGQAPGPALT
                     DWARVREELASTGPPVVAMPVVIKTEGPAWTPLEPKLITRLADTVRTKGLRSPITMAEV
                     EALMSSPLLPHDVTNLMRVILGPAPYALWMDAWGVQLQTVIAAATRDPRHPANGQGRGE
                     RTNLDRLKGLADGMVGNPQGQAALLRPGELVAITASALQAFREVARLAEPAGPWADITQ
                     GPSESFVDFANRLIKAVEGSDLPPSARAPVIIDCFRQKSQPDIQQLIRAAPSTLTTPGE
                     IIKYVLDRQKIAPLTDQGIAAAMSSAIQPLVMAVVNRERDGQTGSGGRARGLCYTCGSP
                     GHYQAQCPKKRKSGNSRERCQLCDGMGHNAKQCRKRDGNQGQRPGRGLSSGPWPGPEQP
                     AVSLAMTMEHKDRPLVRVILTNTGSHPVKQRSVYITALLDSGADITIISEEDWPTDWPV
                     VDTANPQIHGIGGGIPMRKSRDMIEVGVINRDGSLERPLLLFPAVAMVRGSILGRDCLQ
                     GLGLRLTNL"
     gene            739..2850
                     /gene="gag"
                     /label=gag
     CDS             2868..5555
                     /codon_start=1
                     /gene="pol"
                     /product="reverse transcriptase"
                     /label=pol
                     /protein_id="BAC65350.1"
                     /translation="TVALHLAIPLKWKSDRTPVWIDQWPLPEGKLVALTQLVEKELQLG
                     HIEPSLSCWNTPVFVIRKASGSYRLLHDLRAVNAKLVPFGAVQQGAPVLSALPRGWPLM
                     VLDLKDCFFSIPLAEQDREAFAFTLPSVNNQAPARRFQWKVLPQGMTCSPTICQLVVGQ
                     VLEPLRLKHPALRMLHYMDDLLLAASSHDGLEAAGKEVIGTLERAGFTISPDKIQREPG
                     VQYLGYKLGSTYVAPVGLVAEPRIATLWDVQKLVGSLQWLRPALGIPPRLMGPFYEQLR
                     GSDPNEAREWNLDMKMAWREIVQLSTTAALERWDPAQPLEGAVARCEQGAIGVLGQGLS
                     THPRPCLWLFSTQPTKAFTAWLEVLTLLITKLRASAVRTFGKEVDILLLPACFREDLPL
                     PEGILLALRGFAGKIRSSDTPSIFDIARPLHVSLKVRVTDHPVPGPTVFTDASSSTHKG
                     VVVWREGPRWEIKEIVDLGASVQQLEARAVAMALLLWPTTPTNVVTDSAFVAKMLLKMG
                     QEGVPSTAAAFILEDALSQRSAMAAVLHVRSHSEVPGFFTEGNDVADSQATFQAYPLRE
                     AKDLHTALHIGPRALSKACNISMQQAREVVQTCPHCNSAPALEAGVNPRGLGPLQIWQT
                     DFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDN
                     GSCFTSKSTREWLARWGIAHTTGIPGNSQGQAMVERANRLLKDKIRVLAEGDGFMKRIP
                     ASKQGELLAKAMYALNHFERGENTKTPVQKHWRPTVLTEGPPVKIRIETGEWEKGWNVL
                     VWGRGYAAVKNRDTDKVIWVPSRKVKPDVTQKDEVTKKDEASPLFAGISDWIPWEDEQE
                     GLQGETASNKQERPGEDTLAANES"
     gene            2868..5555
                     /gene="pol"
                     /label=pol
     CDS             5443..7248
                     /codon_start=1
                     /gene="env"
                     /product="envelope protein"
                     /label=env
                     /protein_id="BAC65351.1"
                     /translation="AFLTGYPGKTSKKDSKEKPLATSKKDPEKTPLLPTRVNYILIIGV
                     LVLCEVTGVRADVHLLEQPGNLWITWANRTGQTDFCLSTQSATSPFQTCLIGIPSPISE
                     GDFKGYVSDTNCTTLGTDRLVSSADFTGGPDNSTTLTYRKVSCLLLKLNVSMWDEPPEL
                     QLLGSQSLPNITNIAQISGITGGCVGFRPQGVPWYLGWSRQEATRFLLRHPSFSKSTEP
                     FTVVTADRHNLFMGSEYCGAYGYRFWNMYNCSQVGRQYRCGNARSPRPGLPEIQCTRRG
                     GKWVNQSQEINESEPFSFTVNCTASSLGNASGCCGKAGTILPGKWVDSTQGSFTKPKAL
                     PPAIFLICGDRAWQGIPSRPVGGPCYLGKLTMLAPKHTDILKVLVNSSRTGIRRKRSTS
                     HLDDTCSDEVQLWGPTARIFASILAPGVAAAQALREIERLACWSVKQANLTTSLLGDLL
                     DDVTSIRHAVLQNRAAIDFLLLAHGHGCEDVAGMCCFNLSDQSESIQKKFQLMKEHVNK
                     IGVDSDLIGSWLRGLFGGIGEWAVHLLKGLLLGLVVILLLVVCLPCLLQMLCGNRRKMI
                     NNSISYHTEYKKLQKACGQPESRIV"
     gene            5443..7248
                     /gene="env"
                     /label=env
     misc_feature    7387..7421
                     /label=polylinker sequence
                     /note="polylinker sequence"
     promoter        7558..7819
                     /label=RSV promoter
                     /note="Rous sarcoma virus enhancer/promoter"
     repeat_region   7558..7807
     misc_feature    8043..11572
                     /label=pBR322-derived sequence
                     /note="pBR322-derived sequence"
     promoter        complement(8384..8412)
                     /label=tet promoter
                     /note="E. coli promoter for tetracycline efflux protein 
                     gene"
     promoter        8525..8629
                     /gene="bla"
                     /label=AmpR promoter
     CDS             8630..9490
                     /codon_start=1
                     /gene="bla"
                     /product="beta-lactamase"
                     /label=bla
                     /protein_id="BAC65352.1"
                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW
                     EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS
                     LIKHW"
     gene            8630..9490
                     /gene="bla"
                     /label=bla
     rep_origin      9661..10249
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     misc_feature    10435..10575
                     /label=bom
                     /note="basis of mobility region from pBR322"
     CDS             complement(10677..10868)
                     /codon_start=1
                     /gene="rop"
                     /product="Rop protein, which maintains plasmids at low copy
                     number"
                     /label=rop
                     /translation="MTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHA
                     DELYRSCLARFGDDGENL"

This page is informational only.