NovoPro
Cart 2

ZsYellow1 DNA & Amino acid Sequence

LOCUS       Exported                 696 bp ds-DNA    linear   SYN 08-9-2012
DEFINITION  Zoanthus yellow fluorescent protein.
ACCESSION   .
VERSION     .
KEYWORDS    ZsYellow1
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 696)
  AUTHORS   Clontech
  TITLE     Direct Submission
COMMENT     Mammalian codon-optimized.
FEATURES             Location/Qualifiers
     source          1..696
                     /organism="synthetic DNA construct"
                     /lab_host="Mammalian Cells"
                     /mol_type="other DNA"
     CDS             1..696
                     /codon_start=1
                     /product="Zoanthus yellow fluorescent protein"
                     /note="ZsYellow1"
                     /note="mammalian codon-optimized"
                     /translation="MAHSKHGLKEEMTMKYHMEGCVNGHKFVITGEGIGYPFKGKQTIN
                     LCVIEGGPLPFSEDILSAGFKYGDRIFTEYPQDIVDYFKNSCPAGYTWGRSFLFEDGAV
                     CICNVDITVSVKENCIYHKSIFNGVNFPADGPVMKKMTTNWEASCEKIMPVPKQGILKG
                     DVSMYLLLKDGGRYRCQFDTVYKAKSVPSKMPEWHFIQHKLLREDRSDAKNQKWQLTEH
                     AIAFPSALA"
ORIGIN
        1 atggcccaca gcaagcacgg cctgaaggag gagatgacca tgaagtacca catggagggc
       61 tgcgtgaacg gccacaagtt cgtgatcacc ggcgagggca tcggctaccc cttcaagggc
      121 aagcagacca tcaacctgtg cgtgatcgag ggcggccccc tgcccttcag cgaggacatc
      181 ctgagcgccg gcttcaagta cggcgaccgg atcttcaccg agtaccccca ggacatcgtg
      241 gactacttca agaacagctg ccccgccggc tacacctggg gccggagctt cctgttcgag
      301 gacggcgccg tgtgcatctg taacgtggac atcaccgtga gcgtgaagga gaactgcatc
      361 taccacaaga gcatcttcaa cggcgtgaac ttccccgccg acggccccgt gatgaagaag
      421 atgaccacca actgggaggc cagctgcgag aagatcatgc ccgtgcctaa gcagggcatc
      481 ctgaagggcg acgtgagcat gtacctgctg ctgaaggacg gcggccggta ccggtgccag
      541 ttcgacaccg tgtacaaggc caagagcgtg cccagcaaga tgcccgagtg gcacttcatc
      601 cagcacaagc tgctgcggga ggaccggagc gacgccaaga accagaagtg gcagctgacc
      661 gagcacgcca tcgccttccc cagcgccctg gcctga
//

Souce: NovoPro    2018-11-28