NovoPro
Cart 2

ZsGreen1 DNA & Amino acid Sequence

LOCUS       Exported                 696 bp ds-DNA    linear   SYN 08-9-2012
DEFINITION  Zoanthus green fluorescent protein.
ACCESSION   .
VERSION     .
KEYWORDS    ZsGreen1
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 696)
  AUTHORS   Clontech
  TITLE     Direct Submission
COMMENT     Mammalian codon-optimized.
FEATURES             Location/Qualifiers
     source          1..696
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     CDS             1..696
                     /codon_start=1
                     /product="Zoanthus green fluorescent protein"
                     /note="ZsGreen1"
                     /note="mammalian codon-optimized"
                     /translation="MAQSKHGLTKEMTMKYRMEGCVDGHKFVITGEGIGYPFKGKQAIN
                     LCVVEGGPLPFAEDILSAAFMYGNRVFTEYPQDIVDYFKNSCPAGYTWDRSFLFEDGAV
                     CICNADITVSVEENCMYHESKFYGVNFPADGPVMKKMTDNWEPSCEKIIPVPKQGILKG
                     DVSMYLLLKDGGRLRCQFDTVYKAKSVPRKMPDWHFIQHKLTREDRSDAKNQKWHLTEH
                     AIASGSALP"
ORIGIN
        1 atggcccagt ccaagcacgg cctgaccaag gagatgacca tgaagtaccg catggagggc
       61 tgcgtggacg gccacaagtt cgtgatcacc ggcgagggca tcggctaccc cttcaagggc
      121 aagcaggcca tcaacctgtg cgtggtggag ggcggcccct tgcccttcgc cgaggacatc
      181 ttgtccgccg ccttcatgta cggcaaccgc gtgttcaccg agtaccccca ggacatcgtc
      241 gactacttca agaactcctg ccccgccggc tacacctggg accgctcctt cctgttcgag
      301 gacggcgccg tgtgcatctg caacgccgac atcaccgtga gcgtggagga gaactgcatg
      361 taccacgagt ccaagttcta cggcgtgaac ttccccgccg acggccccgt gatgaagaag
      421 atgaccgaca actgggagcc ctcctgcgag aagatcatcc ccgtgcccaa gcagggcatc
      481 ttgaagggcg acgtgagcat gtacctgctg ctgaaggacg gtggccgctt gcgctgccag
      541 ttcgacaccg tgtacaaggc caagtccgtg ccccgcaaga tgcccgactg gcacttcatc
      601 cagcacaagc tgacccgcga ggaccgcagc gacgccaaga accagaagtg gcacctgacc
      661 gagcacgcca tcgcctccgg ctccgccttg ccctga
//

Souce: NovoPro    2018-11-28