NovoPro
Cart 2

ZsGreen DNA & Amino acid Sequence

LOCUS       Exported                 696 bp ds-DNA    linear   SYN 03-5-2013
DEFINITION  Zoanthus green fluorescent protein, also known as zFP506.
ACCESSION   .
VERSION     .
KEYWORDS    ZsGreen
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 696)
  AUTHORS   Matz MV, Fradkov AF, Labas YA, Savitsky AP, Zaraisky AG, Markelov 
            ML, Lukyanov SA.
  TITLE     Fluorescent proteins from nonbioluminescent Anthozoa species.
  JOURNAL   Nat. Biotechnol. 1999;17:969-73.
  PUBMED    10504696
REFERENCE   2  (bases 1 to 696)
  AUTHORS   Clontech
  TITLE     Direct Submission
COMMENT     Brightness was enhanced by a single Asn-to-Met amino acid 
FEATURES             Location/Qualifiers
     source          1..696
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     CDS             1..696
                     /codon_start=1
                     /product="Zoanthus green fluorescent protein (Matz et al., 
                     1999)"
                     /note="ZsGreen"
                     /translation="MAQSKHGLTKEMTMKYRMEGCVDGHKFVITGEGIGYPFKGKQAIN
                     LCVVEGGPLPFAEDILSAAFMYGNRVFTEYPQDIADYFKNSCPAGYTWDRSFLFEDGAV
                     CICNADITVSVEENCMYHESKFYGVNFPADGPVMKKMTDNWEPSCEKIIPVPKQGILKG
                     DVSMYLLLKDGGRLRCQFDTVYKAKSVPRKMPDWHFIQHKLTREDRSDAKNQKWHLTEH
                     AIASGSALP"
ORIGIN
        1 atggctcagt caaagcacgg tctaacaaaa gaaatgacaa tgaaataccg tatggaaggg
       61 tgcgtcgatg gacataaatt tgtgatcacg ggagagggca ttggatatcc gttcaaaggg
      121 aaacaggcta ttaatctgtg tgtggtcgaa ggtggaccat tgccatttgc cgaagacata
      181 ttgtcagctg cctttatgta cggaaacagg gttttcactg aatatcctca agacatagct
      241 gactatttca agaactcgtg tcctgctggt tatacatggg acaggtcttt tctctttgag
      301 gatggagcag tttgcatatg taatgcagat ataacagtga gtgttgaaga aaactgcatg
      361 tatcatgagt ccaaatttta tggagtgaat tttcctgctg atggacctgt gatgaaaaag
      421 atgacagata actgggagcc atcctgcgag aagatcatac cagtacctaa gcaggggata
      481 ttgaaagggg atgtctccat gtacctcctt ctgaaggatg gtgggcgttt acggtgccaa
      541 ttcgacacag tttacaaagc aaagtctgtg ccaagaaaga tgccggactg gcacttcatc
      601 cagcataagc tcacccgtga agaccgcagc gatgctaaga atcagaaatg gcatctgaca
      661 gaacatgcta ttgcatccgg atctgcattg ccctga
//

Souce: NovoPro    2018-11-28