NovoPro
Cart 2

YPet (humanized) DNA & Amino acid Sequence

LOCUS       Exported                 720 bp ds-DNA    linear   SYN 26-11-2013
DEFINITION  Yellow fluorescent protein optimized for FRET with CyPet and for 
            expression in mammalian cells.
ACCESSION   .
VERSION     .
KEYWORDS    YPet (humanized)
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 720)
  AUTHORS   Nguyen AW, Daugherty PS.
  TITLE     Evolutionary optimization of fluorescent proteins for intracellular 
            FRET.
  JOURNAL   Nat. Biotechnol. 2005;23:355-60.
  PUBMED    15696158
REFERENCE   2  (bases 1 to 720)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     Mammalian codon-optimized.
FEATURES             Location/Qualifiers
     source          1..720
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     CDS             1..720
                     /codon_start=1
                     /product="yellow fluorescent protein optimized for FRET 
                     with CyPet (Nguyen and Daugherty, 2005)"
                     /note="YPet"
                     /note="mammalian codon-optimized"
                     /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL
                     KLLCTTGKLPVPWPTLVTTLGYGVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDD
                     GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIK
                     ANFKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSYQSALFKDPNEKRDHMVLL
                     EFLTAAGITEGMNELYK"
ORIGIN
        1 atggtgagca aaggcgaaga gctgttcacc ggcgtggtgc ccatcctggt ggagctggac
       61 ggcgacgtga acggccacaa gttcagcgtg agcggcgagg gcgagggcga cgccacctac
      121 ggcaagctga ccctgaagct gctgtgcacc accggcaagc tgcccgtgcc ctggcccacc
      181 ctggtgacca ccctgggcta cggcgtgcag tgcttcgccc ggtaccccga ccacatgaag
      241 cagcacgact tcttcaagag cgccatgccc gagggctacg tgcaggagcg gaccatcttc
      301 ttcaaggacg acggcaacta caagacccgg gccgaggtga agttcgaggg cgacaccctg
      361 gtgaaccgga tcgagctgaa gggcatcgac ttcaaggagg acggcaacat cctgggccac
      421 aagctggagt acaactacaa cagccacaac gtgtacatca ccgccgacaa gcagaagaac
      481 ggcatcaagg ccaacttcaa gatccggcac aacatcgagg acggcggcgt gcagctggcc
      541 gaccactacc agcagaacac ccccatcggc gacggccccg tgctgctgcc cgacaaccac
      601 tacctgagct accagagcgc cctgttcaag gaccccaacg agaagcggga ccacatggtg
      661 ctgctggagt tcctgaccgc cgccggcatc accgagggca tgaacgagct ctataagtaa
//

Souce: NovoPro    2018-11-28