NovoPro
Cart 2

YPet DNA & Amino acid Sequence

LOCUS       Exported                 714 bp ds-DNA    linear   SYN 03-5-2013
DEFINITION  Yellow fluorescent protein optimized for FRET with CPet.
ACCESSION   .
VERSION     .
KEYWORDS    YPet
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 714)
  AUTHORS   Nguyen AW, Daugherty PS.
  TITLE     Evolutionary optimization of fluorescent proteins for intracellular 
            FRET.
  JOURNAL   Nat. Biotechnol. 2005;23:355-60.
  PUBMED    15696158
REFERENCE   2  (bases 1 to 714)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..714
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     CDS             1..714
                     /codon_start=1
                     /product="yellow fluorescent protein optimized for FRET 
                     with CyPet (Nguyen and Daugherty, 2005)"
                     /note="YPet"
                     /translation="MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLK
                     LLCTTGKLPVPWPTLVTTLGYGVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDG
                     NYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIKA
                     NFKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSYQSALFKDPNEKRDHMVLLE
                     FLTAAGITEGMNELYK"
ORIGIN
        1 atgtctaaag gtgaagaatt attcactggt gttgtcccaa ttttggttga attagatggt
       61 gatgttaatg gtcacaaatt ttctgtctcc ggtgaaggtg aaggtgatgc tacgtacggt
      121 aaattgacct taaaattact ctgtactact ggtaaattgc cagttccatg gccaacctta
      181 gtcactactt taggttatgg tgttcaatgt tttgctagat acccagatca tatgaaacaa
      241 catgactttt tcaagtctgc catgccagaa ggttatgttc aagaaagaac tatttttttc
      301 aaagatgacg gtaactacaa gaccagagct gaagtcaagt ttgaaggtga taccttagtt
      361 aatagaatcg aattaaaagg tattgatttt aaagaagatg gtaacatttt aggtcacaaa
      421 ttggaataca actataactc tcacaatgtt tacatcactg ctgacaaaca aaagaatggt
      481 atcaaagcta acttcaaaat tagacacaac attgaagatg gtggtgttca attagctgac
      541 cattatcaac aaaatactcc aattggtgat ggtccagtct tgttaccaga caaccattac
      601 ttatcctatc aatctgcctt attcaaagat ccaaacgaaa agagagacca catggtcttg
      661 ttagaatttt tgactgctgc tggtattacc gagggtatga atgaattgta caaa
//

Souce: NovoPro    2018-11-28