NovoPro
Cart 2

yeGFP DNA & Amino acid Sequence

LOCUS       Exported                 717 bp ds-DNA    linear   SYN 17-8-2013
DEFINITION  Yeast codon-optimized gene for enhanced Aequoria victoria green 
            fluorescent protein.
ACCESSION   U73901
VERSION     .
KEYWORDS    yeGFP
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 717)
  AUTHORS   Cormack BP, Bertram G, Egerton M, Gow NA, Falkow S, Brown AJ.
  TITLE     Yeast-enhanced green fluorescent protein (yEGFP): a reporter of gene
            expression in Candida albicans.
  JOURNAL   Microbiology (Reading, Engl.) 1997;143 ( Pt 2):303-11.
  PUBMED    9043107
REFERENCE   2  (bases 1 to 717)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     Also known as GFP mutant 3.
FEATURES             Location/Qualifiers
     source          1..717
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     CDS             1..717
                     /codon_start=1
                     /gene="
                     "
                     /product="yeast-enhanced green fluorescent protein"
                     /note="yeGFP"
                     /note="codons optimized for translation in S. cerevisiae 
                     and C. albicans"
                     /protein_id="
                     "
                     /translation="MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLK
                     FICTTGKLPVPWPTLVTTFGYGVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDG
                     NYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKV
                     NFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLE
                     FVTAAGITHGMDELYK"
ORIGIN
        1 atgtctaaag gtgaagaatt attcactggt gttgtcccaa ttttggttga attagatggt
       61 gatgttaatg gtcacaaatt ttctgtctcc ggtgaaggtg aaggtgatgc tacttacggt
      121 aaattgacct taaaatttat ttgtactact ggtaaattgc cagttccatg gccaacctta
      181 gtcactactt tcggttatgg tgttcaatgt tttgctagat acccagatca tatgaaacaa
      241 catgactttt tcaagtctgc catgccagaa ggttatgttc aagaaagaac tatttttttc
      301 aaagatgacg gtaactacaa gaccagagct gaagtcaagt ttgaaggtga taccttagtt
      361 aatagaatcg aattaaaagg tattgatttt aaagaagatg gtaacatttt aggtcacaaa
      421 ttggaataca actataactc tcacaatgtt tacatcatgg ctgacaaaca aaagaatggt
      481 atcaaagtta acttcaaaat tagacacaac attgaagatg gttctgttca attagctgac
      541 cattatcaac aaaatactcc aattggtgat ggtccagtct tgttaccaga caaccattac
      601 ttatccactc aatctgcctt atccaaagat ccaaacgaaa agagagacca catggtcttg
      661 ttagaatttg ttactgctgc tggtattacc catggtatgg atgaattgta caaataa
//

Souce: NovoPro    2018-11-28