NovoPro
Cart 2

TurboYFP DNA & Amino acid Sequence

LOCUS       Exported                 732 bp ds-DNA    linear   SYN 08-9-2012
DEFINITION  Enhanced derivative of PhiYFP.
ACCESSION   .
VERSION     .
KEYWORDS    TurboYFP
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 732)
  AUTHORS   Evrogen
  TITLE     Direct Submission
COMMENT     Mammalian codon-optimized.
FEATURES             Location/Qualifiers
     source          1..732
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     CDS             1..732
                     /codon_start=1
                     /product="enhanced derivative of PhiYFP"
                     /note="TurboYFP"
                     /note="mammalian codon-optimized"
                     /translation="MSSGALLFHGKIPYVVEMEGNVDGHTFSIRGKGYGDASVGKVDAQ
                     FICTTGDVPVPWSTLVTTLTYGAQCFAKYGPELKDFYKSCMPDGYVQERTITFEGDGNF
                     KTRAEVTFENGSVYNRVKLNGQGFKKDGHVLGKNLEFNFTPHCLYIWGDQANHGLKSAF
                     KICHEITGSKGDFIVADHTQMNTPIGGGPVHVPEYHHMSYHVKLSKDVTDHRDNMSLKE
                     TVRAVDCRKTYDFDAGSGDTS"
ORIGIN
        1 atgagcagcg gcgccctgct gttccacggc aagatcccct acgtggtgga gatggagggc
       61 aatgtggatg gccacacctt cagcatccgc ggcaagggct acggcgatgc cagcgtgggc
      121 aaggtggatg cccagttcat ctgcaccacc ggcgatgtgc ccgtgccctg gagcaccctg
      181 gtgaccaccc tgacctacgg cgcccagtgc ttcgccaagt acggccccga gctgaaggat
      241 ttctacaaga gctgcatgcc cgatggctac gtgcaggagc gcaccatcac cttcgagggc
      301 gatggcaatt tcaagacccg cgccgaggtg accttcgaga atggcagcgt gtacaatcgc
      361 gtgaagctga atggccaggg cttcaagaag gatggccacg tgctgggcaa gaatctggag
      421 ttcaatttca ccccccactg cctgtacatc tggggcgatc aggccaatca cggcctgaag
      481 agcgccttca aaatctgcca cgagatcacc ggcagcaagg gcgatttcat cgtggccgat
      541 cacacccaga tgaatacccc catcggcggc ggccccgtgc acgtgcccga gtaccaccac
      601 atgagctacc acgtgaagct gagcaaggat gtgaccgatc accgcgataa tatgagcctg
      661 aaggagaccg tgcgcgccgt ggattgccgc aagacctacg acttcgacgc cggttccgga
      721 gatacaagct aa
//

Souce: NovoPro    2018-11-28