NovoPro
Cart 2

TurboRFP DNA & Amino acid Sequence

LOCUS       Exported                 696 bp ds-DNA    linear   SYN 08-9-2012
DEFINITION  Red fluorescent protein from Entacmaea quadricolor.
ACCESSION   .
VERSION     .
KEYWORDS    TurboRFP
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 696)
  AUTHORS   Evrogen
  TITLE     Direct Submission
COMMENT     Mammalian codon-optimized.
FEATURES             Location/Qualifiers
     source          1..696
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     CDS             1..696
                     /codon_start=1
                     /product="red fluorescent protein from Entacmaea 
                     quadricolor"
                     /note="TurboRFP"
                     /note="mammalian codon-optimized"
                     /translation="MSELIKENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTMKIKV
                     VEGGPLPFAFDILATSFMYGSKAFINHTQGIPDFFKQSFPEGFTWERITTYEDGGVLTA
                     TQDTSFQNGCIIYNVKINGVNFPSNGPVMQKKTRGWEANTEMLYPADGGLRGHSQMALK
                     LVGGGYLHCSFKTTYRSKKPAKNLKMPGFHFVDHRLERIKEADKETYVEQHEMAVAKYC
                     DLPSKLGHR"
ORIGIN
        1 atgagcgagc tgatcaagga gaacatgcac atgaagctgt acatggaggg caccgtgaac
       61 aaccaccact tcaagtgcac atccgagggc gaaggcaagc cctacgaggg cacccagacc
      121 atgaagatca aggtggtcga gggcggccct ctccccttcg ccttcgacat cctggctacc
      181 agcttcatgt acggcagcaa agccttcatc aaccacaccc agggcatccc cgacttcttt
      241 aagcagtcct tccctgaggg cttcacatgg gagagaatca ccacatacga agacgggggc
      301 gtgctgaccg ctacccagga caccagcttc cagaacggct gcatcatcta caacgtcaag
      361 atcaacgggg tgaacttccc atccaacggc cctgtgatgc agaagaaaac acgcggctgg
      421 gaggccaaca ccgagatgct gtaccccgct gacggcggcc tgagaggcca cagccagatg
      481 gccctgaagc tcgtgggcgg gggctacctg cactgctcct tcaagaccac atacagatcc
      541 aagaaacccg ctaagaacct caagatgccc ggcttccact tcgtggacca cagactggaa
      601 agaatcaagg aggccgacaa agagacctac gtcgagcagc acgagatggc tgtggccaag
      661 tactgcgacc tccctagcaa actggggcac agatga
//

Souce: NovoPro    2018-11-28