NovoPro
Cart 2

α-factor secretion signal DNA & Amino acid Sequence

LOCUS       Exported                 267 bp ds-DNA    linear   PLN 07-1-2013
DEFINITION  N-terminal secretion signal from S. cerevisiae alpha-factor.
ACCESSION   .
VERSION     .
KEYWORDS    alpha-factor secretion signal
SOURCE      Saccharomyces cerevisiae
  ORGANISM  Saccharomyces cerevisiae
REFERENCE   1  (bases 1 to 267)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..267
                     /organism="Saccharomyces cerevisiae"
                     /mol_type="genomic DNA"
     CDS             1..267
                     /codon_start=1
                     /gene="MF-alpha-1"
                     /product="N-terminal secretion signal from S. cerevisiae 
                     alpha-factor"
                     /note="alpha-factor secretion signal"
                     /note="Cleavage by the Kex2 protease occurs after the 
                     dibasic KR sequence. The EA dipeptides are then removed by 
                     dipeptidyl aminopeptidase A."
                     /translation="MRFPSIFTAVLFAASSALAAPVNTTTEDETAQIPAEAVIGYLDLE
                     GDFDVAVLPFSNSTNNGLLFINTTIASIAAKEEGVSLDKREAEA"
ORIGIN
        1 atgagatttc cttcaatttt tactgcagtt ttattcgcag catcctccgc attagctgct
       61 ccagtcaaca ctacaacaga agatgaaacg gcacaaattc cggctgaagc tgtcatcggt
      121 tacttagatt tagaagggga tttcgatgtt gctgttttgc cattttccaa cagcacaaat
      181 aacgggttat tgtttataaa tactactatt gccagcattg ctgctaaaga agaaggggta
      241 tctttggata aaagagaggc tgaagct
//

Souce: NovoPro    2018-11-28