NovoPro
Cart 2
  • Neuropeptide Y

Neuropeptide Y

Cat.#: 311598

Size:
Optional Service: TFA RemovalWhat's this?

Special Price 414.0 USD

Availability: 4 weeks
- +

Add to cart to get an online quotation

Product Information

  • Product Name
    Neuropeptide Y
  • Documents
  • Quantity/Unit
    1 Vial
  • Sequence
    YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
  • Three letter code
    Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr
  • Length (aa)
    36
  • Peptide Purity (HPLC)
    97.5
  • Molecular Formula
    C189H285N55O57S
  • Molecular Weight
    4271.5
  • Source
    Synthetic
  • Additional Information
    N-terminal truncation enhances peptide antimicrobial activity. It showed a moderate activity against E. coli ATCC 25922 (MIC 46.5 ug/ml) and very weak activity against S. mutans NCTC 10449, L acidophilus NCTC 1723, E. faecalis NCTC 12697, P. aeruginosa ATCC 27853, and C. albicans NCTC 3179 (MIC 125-280 ug/ml). 3D structure was determined at pH 3.2 and 37oC by 2D NMR. Residues 13-36 form a well-defined amphipathic helix. Dimers co-exist in the NMR solution. You can rotate, zoom, and view the 3D structure here in the PDB. Updated 5/2014; Jan2015. Neuropeptide Y has Antifungal activity. The source of Neuropeptide Y is brain, Homo sapiens.
  • Storage Guidelines
    Ideally Neuropeptide Y should be stored in a freezer at or below -9C. Neuropeptide Y should be refrigerated after reconstitution. For more details, please refer to the manual:Handling and Storage of Synthetic Peptides
  • References
    • Minth CD, Bloom SR, Polak JM, Dixon JE. Cloning, characterization, and DNA sequence of a human cDNA encoding neuropeptide tyrosine. Proc Natl Acad Sci USA. 1984;81(14):4577-81.
  • About TFA salt

    Trifluoroacetic acid (TFA) is a strong acid, which is commonly used to cleave synthesized peptides from solid-phase resins and is also used to improve HPLC performance in the peptide purification step. By default, custom peptides are delivered as lyophilized TFA salts, and can contain as much as 10-45% TFA.

    TFA in custom peptides can cause inexplicable discrepancies in subsequent assay data. For instance, TFA in nM concentrations has been shown to interfere with cellular assays, inhibiting cellular proliferation in some instances, and increasing cell viability in others . It has also been found to be an unintended allosteric modulator of the glycine receptor, GlyR.

    TFA Removal Service is recommended for:

    • Peptides that will be used in cellular assays
    • Peptides that will be used as APIs or in manufactured products
    • For hydrophilic peptides containing numerous basic residues

Peptide Property

  • Analysed Sequence:H-YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-Amidation
  • Chemical Formula:C189H285N55O57S
  • Sequence length:36
  • Extinction coefficient:6400 M-1cm-1
  • GRAVY:-1.19
  • Mw average:4271.66
  • Theoretical pI:7.55
  • Data Source:Peptide Property Calculator

GRAVY = grand average of hydropathy

Red: Hydrophobic uncharged residues, like F I L M V W A and P

Blue: Basic residues, like R K H and N-terminal -NH2

Green: Acidic residues, like D E and C-terminal -COOH

Black: Polar uncharged residues, like G S T C N Q and Y

Peptide Services: NovoPro's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.

Standard Peptide Synthesis: NovoPro offers quality peptides at the most competitive prices in the industry, starting at $3.20 per amino acid. NovoPro provides PepBox – Automatic Quote Tool for online price calculation.

Peptide Modifications: NovoPro offers a wide range of peptide modification services including isotope labeling (2H, 15N, and 13C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"