HFIAP-1 (hagfish cathelicidin, fish, animals; XXH. Also HFIAP-2 ) peptide

HFIAP-1 (hagfish cathelicidin, fish, animals; XXH. Also HFIAP-2 ) peptide

• Handling and Storage of Synthetic Peptides
• Material Safety Data Sheets (MSDS)

GFFKKAWRKVKHAGRRVLDTAKGVGRHYVNNWLNRYR

Gly-Phe-Phe-Lys-Lys-Ala-Trp-Arg-Lys-Val-Lys-His-Ala-Gly-Arg-Arg-Val-Leu-Asp-Thr-Ala-Lys-Gly-Val-Gly-Arg-His-Tyr-Val-Asn-Asn-Trp-Leu-Asn-Arg-Tyr-Arg

37

97%

Synthetic

Powder

W7 and W32 are brominated. Active against Gram+ bacteria P. acnes ATCC 11827 and 33179, S. epidermidi, S. pyogenes, E. faecium, S. aureus ATCC 29213, C. perfringens ATCC 9081 and 13124, E. faecalis (MIC 2-32 uM); Gram- bacteria Bacteroides spp. ATCC 29771, 43935, and 12290, S. sonnei, S. maltophilia, Salmonella Group B, P. aeruginosa ATCC 27853, A. baumannii, E. coli ATCC 25922, E. aerogenes, E. cloacae, K. pneumoniae (MIC 0.5-16). HFIAP-2 is identical to HFIAP-1 in terms of amino acid sequence. However, HFIAP-2 is only brominated at residue W7. Updated 10/2014. HFIAP-1 (hagfish cathelicidin, fish, animals; XXH. Also HFIAP-2 ) was found in Atlantic hagfish, Myxine glutinosa.

Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C. For more details, please refer to the manual:Handling and Storage of Synthetic Peptides

Trifluoroacetic acid (TFA) has a significant impact on peptides due to its role in the peptide synthesis process.

TFA is essential for the protonation of peptides that lack basic amino acids such as Arginine (Arg), Histidine (His), and Lysine (Lys), or ones that have blocked N-termini. As a result, peptides often contain TFA salts in the final product.

TFA residues, when present in custom peptides, can cause unpredictable fluctuations in experimental data. At a nanomolar (nM) level, TFA can influence cell experiments, hindering cell growth at low concentrations (as low as 10 nM) and promoting it at higher doses (0.5–7.0 mM). It can also serve as an allosteric regulator on the GlyR of glycine receptors, thereby increasing receptor activity at lower glycine concentrations.

In an in vivo setting, TFA can trifluoroacetylate amino groups in proteins and phospholipids, inducing potentially unwanted antibody responses. Moreover, TFA can impact structure studies as it affects spectrum absorption.