Basic Vector Information
- Vector Name:
- AviTag-SpyCatcher
- Antibiotic Resistance:
- Ampicillin
- Length:
- 4115 bp
- Type:
- Bacterial Expression
- Replication origin:
- ori
- Copy Number:
- High Copy
- Cloning Method:
- Ligation Independent Cloning
- 5' Primer:
- TAA TAC GAC TCA CTA TAG GG
AviTag-SpyCatcher vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
AviTag-SpyCatcher vector Sequence
LOCUS 40924_325 4115 bp DNA circular SYN 13-MAY-2021 DEFINITION Bacterial expression of SpyCatcher with a peptide tag enabling site-specific biotinylation.. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4115) AUTHORS Veggiani G, Nakamura T, Brenner MD, Gayet RV, Yan J, Robinson CV, Howarth M TITLE Programmable polyproteams built using twin peptide superglues. JOURNAL Proc Natl Acad Sci U S A. 2016 Jan 19. pii: 201519214. PUBMED 26787909 REFERENCE 2 (bases 1 to 4115) TITLE Direct Submission REFERENCE 3 (bases 1 to 4115) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Proc Natl Acad Sci U S A. 2016 Jan 19. pii: 201519214." COMMENT SGRef: number: 2; type: "Journal Article" FEATURES Location/Qualifiers source 1..4115 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 21..39 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" RBS 71..93 /label=RBS /note="efficient ribosome binding site from bacteriophage T7 gene 10 (Olins and Rangwala, 1989)" CDS 113..130 /codon_start=1 /label=6xHis /note="6xHis affinity tag" /translation="HHHHHH" CDS 137..181 /codon_start=1 /label=AviTag(TM) /note="peptide tag that allows for enzymatic biotinylation" /translation="GLNDIFEAQKIEWHE" CDS 206..226 /codon_start=1 /label=TEV site /note="tobacco etch virus (TEV) protease recognition and cleavage site" /translation="ENLYFQG" CDS 636..653 /codon_start=1 /label=6xHis /note="6xHis affinity tag" /translation="HHHHHH" terminator 720..767 /label=T7 terminator /note="transcription terminator for bacteriophage T7 RNA polymerase" rep_origin 804..1259 /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 1285..1389 /label=AmpR promoter CDS 1390..2247 /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="[TEM beta-lactamase fragment, 45 aa] ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS [TEM beta-lactamase fragment, 59 aa] EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA [TEM beta-lactamase fragment, 59 aa] LIKHW" rep_origin 2421..3009 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" primer_bind 3163..3180 /label=L4440 /note="L4440 vector, forward primer" misc_feature complement(3195..3334) /label=bom /note="basis of mobility region from pBR322" primer_bind 3420..3442 /label=pGEX 3' /note="pGEX vectors, reverse primer" CDS complement(3439..3627) /codon_start=1 /label=rop /note="Rop protein, which maintains plasmids at low copy number" /translation="VTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHA DELYRSCLARFGDDGENL"
This page is informational only.