Basic Vector Information
- Vector Name:
- pMON99036
- Antibiotic Resistance:
- Streptomycin
- Length:
- 9808 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Preuss SB, Meister R, Xu Q, Urwin CP, Tripodi FA, Screen SE, Anil VS, Zhu S, Morrell JA, Liu G, Ratcliffe OJ, Reuber TL, Khanna R, Goldman BS, Bell E, Ziegler TE, McClerren AL, Ruff TG, Petracek ME.
pMON99036 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pMON99036 vector Sequence
LOCUS V004677 9808 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V004677 VERSION V004677 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 9808) AUTHORS Preuss SB, Meister R, Xu Q, Urwin CP, Tripodi FA, Screen SE, Anil VS, Zhu S, Morrell JA, Liu G, Ratcliffe OJ, Reuber TL, Khanna R, Goldman BS, Bell E, Ziegler TE, McClerren AL, Ruff TG, Petracek ME. TITLE Expression of the Arabidopsis thaliana BBX32 Gene in Soybean Increases Grain Yield JOURNAL PLoS ONE 7 (2), E30717 (2012) PUBMED 22363475 REFERENCE 2 (bases 1 to 9808) AUTHORS Preuss SB. TITLE Direct Submission REFERENCE 3 (bases 1 to 9808) TITLE Direct Submission REFERENCE 4 (bases 1 to 9808) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "PLoS ONE"; date: "2012"; volume: "7"; issue: "2"; pages: "E30717" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (27-JUL-2011) Yield " SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..9808 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature complement(360..384) /label="LB T-DNA repeat" /note="left border repeat from octopine Ach5 T-DNA" CDS 1760..1948 /label="rop" /note="Rop protein, which maintains plasmids at low copy number" misc_feature 2053..2193 /label="bom" /note="basis of mobility region from pBR322" rep_origin complement(2379..2967) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature 3498..4386 /label="derived from E. coli aadA" /note="derived from E. coli aadA" CDS 3540..4328 /codon_start=1 /gene="aadA" /product="aminoglycoside adenylyltransferase (Murphy, 1985)" /label="SmR" /note="confers resistance to spectinomycin and streptomycin" /translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP VILEARQAYLGQEDRLASRADQLEEFVHYVKGEITKVVGK" misc_feature 4637..4661 /label="LB T-DNA repeat" /note="left border repeat from octopine Ach5 T-DNA" terminator complement(4908..5549) /label="E9 terminator" /note="terminator and polyadenylation signal from the pea rbcS-E9 gene" CDS complement(5559..6923) /gene="aroA" /label="3-phosphoshikimate 1-carboxyvinyltransferase" /note="3-phosphoshikimate 1-carboxyvinyltransferase from Agrobacterium sp. (strain CP4). Accession#: Q9R4E4" misc_feature complement(6924..7151) /label="derived from A. thaliana ShkG" /note="derived from A. thaliana ShkG" 5'UTR complement(7161..7828) /label="derived from A. thaliana Tsf1" /note="derived from A. thaliana Tsf1" regulatory complement(7829..8308) /label="derived from A. thaliana Tsf1" /note="derived from A. thaliana Tsf1" /regulatory_class="promoter" regulatory complement(8332..8868) /label="FMV 35S" /note="FMV 35S" /regulatory_class="enhancer" misc_feature 8931..8955 /label="RB T-DNA repeat" /note="right border repeat from nopaline C58 T-DNA" misc_feature complement(9711..9735) /label="RB T-DNA repeat" /note="right border repeat from nopaline C58 T-DNA"
This page is informational only.