pMON99036 vector (V004677)

Basic Vector Information

Vector Name:
pMON99036
Antibiotic Resistance:
Streptomycin
Length:
9808 bp
Type:
Expression vector
Replication origin:
ori
Source/Author:
Preuss SB, Meister R, Xu Q, Urwin CP, Tripodi FA, Screen SE, Anil VS, Zhu S, Morrell JA, Liu G, Ratcliffe OJ, Reuber TL, Khanna R, Goldman BS, Bell E, Ziegler TE, McClerren AL, Ruff TG, Petracek ME.

pMON99036 vector Vector Map

pMON990369808 bp4008001200160020002400280032003600400044004800520056006000640068007200760080008400880092009600LB T-DNA repeatropbomoriderived from E. coli aadALB T-DNA repeatE9 terminator3-phosphoshikimate 1-carboxyvinyltransferasederived from A. thaliana ShkG5'UTRderived from A. thaliana Tsf1FMV 35SRB T-DNA repeatRB T-DNA repeat

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

pMON99036 vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       V004677                 9808 bp    DNA     circular SYN 18-DEC-2018
DEFINITION  Exported.
ACCESSION   V004677
VERSION     V004677
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 9808)
  AUTHORS   Preuss SB, Meister R, Xu Q, Urwin CP, Tripodi FA, Screen SE, Anil
            VS, Zhu S, Morrell JA, Liu G, Ratcliffe OJ, Reuber TL, Khanna R,
            Goldman BS, Bell E, Ziegler TE, McClerren AL, Ruff TG, Petracek ME.
  TITLE     Expression of the Arabidopsis thaliana BBX32 Gene in Soybean
            Increases Grain Yield
  JOURNAL   PLoS ONE 7 (2), E30717 (2012)
   PUBMED   22363475
REFERENCE   2  (bases 1 to 9808)
  AUTHORS   Preuss SB.
  TITLE     Direct Submission
REFERENCE   3  (bases 1 to 9808)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 9808)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "PLoS ONE";
            date: "2012"; volume: "7"; issue: "2"; pages: "E30717"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (27-JUL-2011) Yield "
            SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..9808
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     misc_feature    complement(360..384)
                     /label="LB T-DNA repeat"
                     /note="left border repeat from octopine Ach5 T-DNA"
     CDS             1760..1948
                     /label="rop"
                     /note="Rop protein, which maintains plasmids at low copy
                     number"
     misc_feature    2053..2193
                     /label="bom"
                     /note="basis of mobility region from pBR322"
     rep_origin      complement(2379..2967)
                     /direction=LEFT
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     misc_feature    3498..4386
                     /label="derived from E. coli aadA"
                     /note="derived from E. coli aadA"
     CDS             3540..4328
                     /codon_start=1
                     /gene="aadA"
                     /product="aminoglycoside adenylyltransferase (Murphy,
                     1985)"
                     /label="SmR"
                     /note="confers resistance to spectinomycin and
                     streptomycin"
                     /translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH
                     SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK
                     RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF
                     EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP
                     VILEARQAYLGQEDRLASRADQLEEFVHYVKGEITKVVGK"
     misc_feature    4637..4661
                     /label="LB T-DNA repeat"
                     /note="left border repeat from octopine Ach5 T-DNA"
     terminator      complement(4908..5549)
                     /label="E9 terminator"
                     /note="terminator and polyadenylation signal from the pea
                     rbcS-E9 gene"
     CDS             complement(5559..6923)
                     /gene="aroA"
                     /label="3-phosphoshikimate 1-carboxyvinyltransferase"
                     /note="3-phosphoshikimate 1-carboxyvinyltransferase from
                     Agrobacterium sp. (strain CP4). Accession#: Q9R4E4"
     misc_feature    complement(6924..7151)
                     /label="derived from A. thaliana ShkG"
                     /note="derived from A. thaliana ShkG"
     5'UTR           complement(7161..7828)
                     /label="derived from A. thaliana Tsf1"
                     /note="derived from A. thaliana Tsf1"
     regulatory      complement(7829..8308)
                     /label="derived from A. thaliana Tsf1"
                     /note="derived from A. thaliana Tsf1"
                     /regulatory_class="promoter"
     regulatory      complement(8332..8868)
                     /label="FMV 35S"
                     /note="FMV 35S"
                     /regulatory_class="enhancer"
     misc_feature    8931..8955
                     /label="RB T-DNA repeat"
                     /note="right border repeat from nopaline C58 T-DNA"
     misc_feature    complement(9711..9735)
                     /label="RB T-DNA repeat"
                     /note="right border repeat from nopaline C58 T-DNA"

This page is informational only.