Cagrilintide peptide (TFA removed)

Cagrilintide peptide (TFA removed)

• COA/MS/HPLC Report
• Handling and Storage of Synthetic Peptides
• Material Safety Data Sheets (MSDS)

Batch to batch variation of the purity

{Eicosanedioic-acid-γ-Glu}-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2 (Disulfide bridge:C3-C8)

{Eicosanedioic-acid-γ-Glu}-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Glu-Phe-Leu-Arg-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Pro-NH2 (Disulfide bridge:Cys3-Cys8)

39

95.2%

C₁₉₄H₃₁₂N₅₄O₅₉S₂

4409.01

1415456-99-3

167312356

Synthetic

Powder

Cagrilintide is a non-selective AMYR/CTR agonist and long-acting acylated amylase analogue. CagriSema is combined with Cagrilintide and Semaglutide. The clinical phase II trial of CagriSema in diabetic patients was successfully completed with superior weight loss and glucose-lowering effects compared to simethicone. The trial included 92 patients with type 2 diabetes with overweight, randomized equally into 3 groups: CagriSema injection (2.4 mg of simeplutide and 2.4 mg of cagrilintide), 2.4 mg of simeplutide alone, and 2.4 mg of cagrilintide alone. the treatment duration was 32 weeks, and subjects had a mean baseline HbA1c was 8.4% and mean baseline weight was 106 kg. The results showed that in terms of weight loss, CagriSema injection significantly outperformed simepaglutide (5.1%) and cagrilintide (8.1%) by 15.6% of body weight loss.

Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C. For more details, please refer to the manual:Handling and Storage of Synthetic Peptides

• Kruse T, Hansen JL, Dahl K, et al. Development of Cagrilintide, a Long-Acting Amylin Analogue. J Med Chem. 2021;64(15):11183-11194. doi:10.1021/acs.jmedchem.1c00565
• Dehestani B, Stratford NR, le Roux CW. Amylin as a Future Obesity Treatment. J Obes Metab Syndr. 2021;30(4):320-325. doi:10.7570/jomes21071
• Fletcher MM, Keov P, Truong TT, et al. AM833 Is a Novel Agonist of Calcitonin Family G Protein-Coupled Receptors: Pharmacological Comparison with Six Selective and Nonselective Agonists. J Pharmacol Exp Ther. 2021;377(3):417-440. doi:10.1124/jpet.121.000567

Trifluoroacetic acid (TFA) has a significant impact on peptides due to its role in the peptide synthesis process.

TFA is essential for the protonation of peptides that lack basic amino acids such as Arginine (Arg), Histidine (His), and Lysine (Lys), or ones that have blocked N-termini. As a result, peptides often contain TFA salts in the final product.

TFA residues, when present in custom peptides, can cause unpredictable fluctuations in experimental data. At a nanomolar (nM) level, TFA can influence cell experiments, hindering cell growth at low concentrations (as low as 10 nM) and promoting it at higher doses (0.5–7.0 mM). It can also serve as an allosteric regulator on the GlyR of glycine receptors, thereby increasing receptor activity at lower glycine concentrations.

In an in vivo setting, TFA can trifluoroacetylate amino groups in proteins and phospholipids, inducing potentially unwanted antibody responses. Moreover, TFA can impact structure studies as it affects spectrum absorption.